PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma89g00960.1
Common NameZOSMA_89G00960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family bHLH
Protein Properties Length: 89aa    MW: 9990.41 Da    PI: 6.52
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma89g00960.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH231.5e-0714541454
                     HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     d+iN+ +++L+ llP+a +++  + s    L ++++YIksL
  Zosma89g00960.1 14 DEINELISKLQLLLPEARRNSMARASATKLLNETCNYIKSL 54
                     68**************88999999****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.731154IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.4E-51454IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.0E-81470IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.44E-71474IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MSGRRSSGSR ITEDEINELI SKLQLLLPEA RRNSMARASA TKLLNETCNY IKSLHREMDD  60
LSDRLSNLML TMDTDSAQAE IIRSLLLH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937075.12e-38PREDICTED: transcription factor ILI5-like
SwissprotQ6YUX01e-32ILI5_ORYSJ; Transcription factor ILI5
SwissprotA2X9L81e-32ILI5_ORYSI; Transcription factor ILI5
TrEMBLA0A0K9NKL02e-56A0A0K9NKL0_Z
STRINGGSMUA_Achr1P21650_0012e-36(Musa acuminata)
STRINGGSMUA_Achr9P09010_0011e-36(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92838145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-27bHLH family protein